Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 326813..327380 | Replicon | chromosome |
| Accession | NZ_CP124733 | ||
| Organism | Agrobacterium larrymoorei strain CFBP5477 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | CFBP5477_RS01505 | Protein ID | WP_084631408.1 |
| Coordinates | 327219..327380 (-) | Length | 54 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | CFBP5477_RS01500 | Protein ID | WP_137393234.1 |
| Coordinates | 326813..327214 (-) | Length | 134 a.a. |
Genomic Context
Location: 322414..325065 (2652 bp)
Type: Others
Protein ID: WP_137393231.1
Type: Others
Protein ID: WP_137393231.1
Location: 325182..325907 (726 bp)
Type: Others
Protein ID: WP_234882828.1
Type: Others
Protein ID: WP_234882828.1
Location: 325996..326799 (804 bp)
Type: Others
Protein ID: WP_137393233.1
Type: Others
Protein ID: WP_137393233.1
Location: 328885..329430 (546 bp)
Type: Others
Protein ID: WP_137393236.1
Type: Others
Protein ID: WP_137393236.1
Location: 326813..327214 (402 bp)
Type: Antitoxin
Protein ID: WP_137393234.1
Type: Antitoxin
Protein ID: WP_137393234.1
Location: 327219..327380 (162 bp)
Type: Toxin
Protein ID: WP_084631408.1
Type: Toxin
Protein ID: WP_084631408.1
Location: 327460..327915 (456 bp)
Type: Others
Protein ID: WP_137393235.1
Type: Others
Protein ID: WP_137393235.1
Location: 328058..328741 (684 bp)
Type: Others
Protein ID: WP_027673544.1
Type: Others
Protein ID: WP_027673544.1
Location: 329563..330135 (573 bp)
Type: Others
Protein ID: WP_027673546.1
Type: Others
Protein ID: WP_027673546.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5477_RS01485 (CFBP5477_001485) | 322414..325065 | + | 2652 | WP_137393231.1 | DNA translocase FtsK | - |
| CFBP5477_RS01490 (CFBP5477_001490) | 325182..325907 | + | 726 | WP_234882828.1 | outer membrane lipoprotein carrier protein LolA | - |
| CFBP5477_RS01495 (CFBP5477_001495) | 325996..326799 | + | 804 | WP_137393233.1 | exodeoxyribonuclease III | - |
| CFBP5477_RS01500 (CFBP5477_001500) | 326813..327214 | - | 402 | WP_137393234.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| CFBP5477_RS01505 (CFBP5477_001505) | 327219..327380 | - | 162 | WP_084631408.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| CFBP5477_RS01510 (CFBP5477_001510) | 327460..327915 | - | 456 | WP_137393235.1 | cyclic nucleotide-binding domain-containing protein | - |
| CFBP5477_RS01515 (CFBP5477_001515) | 328058..328741 | - | 684 | WP_027673544.1 | response regulator transcription factor | - |
| CFBP5477_RS01520 (CFBP5477_001520) | 328885..329430 | + | 546 | WP_137393236.1 | L,D-transpeptidase | - |
| CFBP5477_RS01525 (CFBP5477_001525) | 329563..330135 | - | 573 | WP_027673546.1 | CarD family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 5841.95 Da Isoelectric Point: 11.8222
>T281132 WP_084631408.1 NZ_CP124733:c327380-327219 [Agrobacterium larrymoorei]
MKSTDIIAALRKGSHVQFKHASKPGRVTVPHPKRDLPIGTLKSIEKQAGLKLR
MKSTDIIAALRKGSHVQFKHASKPGRVTVPHPKRDLPIGTLKSIEKQAGLKLR
Download Length: 162 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14304.08 Da Isoelectric Point: 4.5459
>AT281132 WP_137393234.1 NZ_CP124733:c327214-326813 [Agrobacterium larrymoorei]
MRNYIGLIHKHADSDYGVSFPDFPGVVTAGTDLDDARLMAEEALSLHVEGLLEDGDAIPEPSSLDDVMKDGENKMAVAIL
VSLKSESKRAVRLNITLPEDVLRDIDAYAQAHGLTRSGFLARAAKHEISSASA
MRNYIGLIHKHADSDYGVSFPDFPGVVTAGTDLDDARLMAEEALSLHVEGLLEDGDAIPEPSSLDDVMKDGENKMAVAIL
VSLKSESKRAVRLNITLPEDVLRDIDAYAQAHGLTRSGFLARAAKHEISSASA
Download Length: 402 bp