Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4820598..4821117 | Replicon | chromosome |
Accession | NZ_CP124732 | ||
Organism | Pseudomonas sp. GM17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1H3UB31 |
Locus tag | PMI20_RS21495 | Protein ID | WP_007930524.1 |
Coordinates | 4820598..4820879 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3G7HDX0 |
Locus tag | PMI20_RS21500 | Protein ID | WP_007930518.1 |
Coordinates | 4820869..4821117 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMI20_RS21470 (PMI20_021470) | 4815806..4816078 | + | 273 | WP_007927368.1 | hypothetical protein | - |
PMI20_RS21475 (PMI20_021475) | 4816777..4816882 | - | 106 | Protein_4244 | AAA family ATPase | - |
PMI20_RS21480 (PMI20_021480) | 4816970..4817761 | + | 792 | WP_007930528.1 | methyltransferase domain-containing protein | - |
PMI20_RS21485 (PMI20_021485) | 4818227..4818709 | + | 483 | WP_007930527.1 | acyl-CoA thioesterase | - |
PMI20_RS21490 (PMI20_021490) | 4818762..4820411 | + | 1650 | WP_007930525.1 | FMN-binding glutamate synthase family protein | - |
PMI20_RS21495 (PMI20_021495) | 4820598..4820879 | - | 282 | WP_007930524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMI20_RS21500 (PMI20_021500) | 4820869..4821117 | - | 249 | WP_007930518.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PMI20_RS21505 (PMI20_021505) | 4821213..4822001 | - | 789 | WP_007930516.1 | helix-turn-helix transcriptional regulator | - |
PMI20_RS21510 (PMI20_021510) | 4822086..4823084 | + | 999 | WP_007930514.1 | bile acid:sodium symporter family protein | - |
PMI20_RS21515 (PMI20_021515) | 4823238..4824041 | - | 804 | WP_007930512.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4812344..4826123 | 13779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10890.73 Da Isoelectric Point: 10.6993
>T281129 WP_007930524.1 NZ_CP124732:c4820879-4820598 [Pseudomonas sp. GM17]
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H3UB31 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7HDX0 |