Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4297292..4297877 | Replicon | chromosome |
Accession | NZ_CP124732 | ||
Organism | Pseudomonas sp. GM17 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PMI20_RS19325 | Protein ID | WP_007923532.1 |
Coordinates | 4297292..4297585 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PMI20_RS19330 | Protein ID | WP_007923531.1 |
Coordinates | 4297587..4297877 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMI20_RS19305 (PMI20_019305) | 4292308..4292703 | - | 396 | WP_007932579.1 | carboxymuconolactone decarboxylase family protein | - |
PMI20_RS19310 (PMI20_019310) | 4292935..4294179 | - | 1245 | WP_007923535.1 | M20/M25/M40 family metallo-hydrolase | - |
PMI20_RS19315 (PMI20_019315) | 4294273..4295397 | - | 1125 | WP_052034467.1 | diguanylate cyclase | - |
PMI20_RS19320 (PMI20_019320) | 4295662..4297056 | + | 1395 | WP_007923533.1 | VOC family protein | - |
PMI20_RS19325 (PMI20_019325) | 4297292..4297585 | + | 294 | WP_007923532.1 | addiction module protein | Toxin |
PMI20_RS19330 (PMI20_019330) | 4297587..4297877 | + | 291 | WP_007923531.1 | putative addiction module antidote protein | Antitoxin |
PMI20_RS19335 (PMI20_019335) | 4298274..4298861 | - | 588 | WP_007923530.1 | hypothetical protein | - |
PMI20_RS19340 (PMI20_019340) | 4298985..4300061 | - | 1077 | WP_007923529.1 | lipocalin-like domain-containing protein | - |
PMI20_RS19345 (PMI20_019345) | 4300051..4302531 | - | 2481 | WP_037034137.1 | FtsX-like permease family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10680.38 Da Isoelectric Point: 11.1294
>T281127 WP_007923532.1 NZ_CP124732:4297292-4297585 [Pseudomonas sp. GM17]
MDYEILQTTAFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSKMRVNMGAGYRISFTLRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTAFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSKMRVNMGAGYRISFTLRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|