Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2283109..2283731 | Replicon | chromosome |
Accession | NZ_CP124732 | ||
Organism | Pseudomonas sp. GM17 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2N8AR08 |
Locus tag | PMI20_RS10320 | Protein ID | WP_007929414.1 |
Coordinates | 2283549..2283731 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PMI20_RS10315 | Protein ID | WP_007929416.1 |
Coordinates | 2283109..2283516 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMI20_RS10295 (PMI20_010295) | 2278413..2279303 | + | 891 | WP_007929421.1 | LysR family transcriptional regulator | - |
PMI20_RS10300 (PMI20_010300) | 2279541..2281319 | + | 1779 | WP_007929420.1 | GGDEF domain-containing phosphodiesterase | - |
PMI20_RS10305 (PMI20_010305) | 2281353..2282267 | - | 915 | WP_007929418.1 | SGNH/GDSL hydrolase family protein | - |
PMI20_RS10310 (PMI20_010310) | 2282397..2282864 | - | 468 | WP_007929417.1 | GAF domain-containing protein | - |
PMI20_RS10315 (PMI20_010315) | 2283109..2283516 | - | 408 | WP_007929416.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PMI20_RS10320 (PMI20_010320) | 2283549..2283731 | - | 183 | WP_007929414.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PMI20_RS10330 (PMI20_010330) | 2284440..2285324 | - | 885 | WP_007929412.1 | alpha/beta hydrolase | - |
PMI20_RS10335 (PMI20_010335) | 2285676..2286368 | - | 693 | WP_007929410.1 | 16S rRNA pseudouridine(516) synthase | - |
PMI20_RS10340 (PMI20_010340) | 2286402..2286620 | - | 219 | WP_274517825.1 | cysteine-rich CWC family protein | - |
PMI20_RS10345 (PMI20_010345) | 2286628..2288115 | - | 1488 | WP_007929401.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6850.15 Da Isoelectric Point: 11.6709
>T281126 WP_007929414.1 NZ_CP124732:c2283731-2283549 [Pseudomonas sp. GM17]
VNSRYLIGQIVADGWYLVRVRGSHHHFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHHFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14670.66 Da Isoelectric Point: 4.4699
>AT281126 WP_007929416.1 NZ_CP124732:c2283516-2283109 [Pseudomonas sp. GM17]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|