Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1051590..1052203 Replicon chromosome
Accession NZ_CP124732
Organism Pseudomonas sp. GM17

Toxin (Protein)


Gene name hicA Uniprot ID A0A5M7CZT0
Locus tag PMI20_RS04695 Protein ID WP_007925285.1
Coordinates 1051590..1051772 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2N8BII0
Locus tag PMI20_RS04700 Protein ID WP_009041686.1
Coordinates 1051802..1052203 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMI20_RS04675 (PMI20_004675) 1048189..1048446 - 258 WP_007925299.1 hypothetical protein -
PMI20_RS04680 (PMI20_004680) 1048686..1049582 - 897 WP_007925288.1 SDR family oxidoreductase -
PMI20_RS04685 (PMI20_004685) 1049702..1050442 - 741 WP_007925287.1 SDR family oxidoreductase -
PMI20_RS04690 (PMI20_004690) 1050581..1051471 + 891 WP_007925286.1 LysR family transcriptional regulator -
PMI20_RS04695 (PMI20_004695) 1051590..1051772 + 183 WP_007925285.1 type II toxin-antitoxin system HicA family toxin Toxin
PMI20_RS04700 (PMI20_004700) 1051802..1052203 + 402 WP_009041686.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMI20_RS04705 (PMI20_004705) 1052787..1053824 + 1038 WP_007925283.1 L-glyceraldehyde 3-phosphate reductase -
PMI20_RS04710 (PMI20_004710) 1053974..1054402 - 429 WP_007925281.1 type II toxin-antitoxin system VapC family toxin -
PMI20_RS04715 (PMI20_004715) 1054399..1054644 - 246 WP_007925278.1 hypothetical protein -
PMI20_RS04720 (PMI20_004720) 1054772..1055611 - 840 WP_007925276.1 taurine dioxygenase -
PMI20_RS04725 (PMI20_004725) 1055667..1056506 - 840 WP_007925274.1 taurine ABC transporter permease TauC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6905.07 Da        Isoelectric Point: 10.3819

>T281124 WP_007925285.1 NZ_CP124732:1051590-1051772 [Pseudomonas sp. GM17]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPKGTIHSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14629.48 Da        Isoelectric Point: 4.7569

>AT281124 WP_009041686.1 NZ_CP124732:1051802-1052203 [Pseudomonas sp. GM17]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAEAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGMI
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5M7CZT0

Antitoxin

Source ID Structure
AlphaFold DB A0A2N8BII0

References