Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 56424..57067 | Replicon | plasmid p3-KP21315 |
| Accession | NZ_CP124705 | ||
| Organism | Klebsiella pneumoniae strain KP21315 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | QJQ34_RS28210 | Protein ID | WP_087548942.1 |
| Coordinates | 56424..56840 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | QJQ34_RS28215 | Protein ID | WP_001261276.1 |
| Coordinates | 56837..57067 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ34_RS28190 (QJQ34_28190) | 51600..52154 | - | 555 | Protein_50 | recombinase family protein | - |
| QJQ34_RS28195 (QJQ34_28195) | 52204..52908 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QJQ34_RS28200 (QJQ34_28200) | 53055..54578 | - | 1524 | WP_087548941.1 | EAL domain-containing protein | - |
| QJQ34_RS28205 (QJQ34_28205) | 55013..56240 | - | 1228 | Protein_53 | IS3 family transposase | - |
| QJQ34_RS28210 (QJQ34_28210) | 56424..56840 | - | 417 | WP_087548942.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJQ34_RS28215 (QJQ34_28215) | 56837..57067 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJQ34_RS28220 (QJQ34_28220) | 57641..57991 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| QJQ34_RS28225 (QJQ34_28225) | 58042..58785 | + | 744 | WP_004098973.1 | hypothetical protein | - |
| QJQ34_RS28230 (QJQ34_28230) | 58782..59558 | + | 777 | WP_023302478.1 | site-specific integrase | - |
| QJQ34_RS28235 (QJQ34_28235) | 59616..59873 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| QJQ34_RS28240 (QJQ34_28240) | 60002..60106 | - | 105 | WP_032410267.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-14 | - | 1..60640 | 60640 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15092.61 Da Isoelectric Point: 8.5403
>T281122 WP_087548942.1 NZ_CP124705:c56840-56424 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|