Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 14214..14739 | Replicon | plasmid p2-KP21315 |
| Accession | NZ_CP124704 | ||
| Organism | Klebsiella pneumoniae strain KP21315 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | QJQ34_RS27445 | Protein ID | WP_013023785.1 |
| Coordinates | 14434..14739 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | QJQ34_RS27440 | Protein ID | WP_001568025.1 |
| Coordinates | 14214..14432 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ34_RS27420 (QJQ34_27420) | 9370..10149 | + | 780 | WP_013023780.1 | hypothetical protein | - |
| QJQ34_RS27425 (QJQ34_27425) | 10425..11948 | + | 1524 | WP_017899887.1 | hypothetical protein | - |
| QJQ34_RS27430 (QJQ34_27430) | 11982..13109 | + | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
| QJQ34_RS27435 (QJQ34_27435) | 13106..13396 | + | 291 | WP_013023783.1 | hypothetical protein | - |
| QJQ34_RS27440 (QJQ34_27440) | 14214..14432 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJQ34_RS27445 (QJQ34_27445) | 14434..14739 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJQ34_RS27450 (QJQ34_27450) | 14908..15303 | + | 396 | WP_017899885.1 | hypothetical protein | - |
| QJQ34_RS27455 (QJQ34_27455) | 15330..15644 | + | 315 | WP_053389906.1 | hypothetical protein | - |
| QJQ34_RS27460 (QJQ34_27460) | 15655..16671 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
| QJQ34_RS27465 (QJQ34_27465) | 16869..17663 | + | 795 | WP_004197635.1 | site-specific integrase | - |
| QJQ34_RS27470 (QJQ34_27470) | 18103..18405 | - | 303 | WP_004197636.1 | hypothetical protein | - |
| QJQ34_RS27475 (QJQ34_27475) | 18402..19028 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..93640 | 93640 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T281121 WP_013023785.1 NZ_CP124704:14434-14739 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |