Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 141274..141926 | Replicon | plasmid p1-KP21315 |
| Accession | NZ_CP124703 | ||
| Organism | Klebsiella pneumoniae strain KP21315 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
| Locus tag | QJQ34_RS26785 | Protein ID | WP_017901321.1 |
| Coordinates | 141274..141699 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | QJQ34_RS26790 | Protein ID | WP_001261275.1 |
| Coordinates | 141696..141926 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ34_RS26750 (QJQ34_26750) | 136983..137099 | + | 117 | Protein_150 | transposase | - |
| QJQ34_RS26755 (QJQ34_26755) | 137224..137394 | - | 171 | Protein_151 | LysR family transcriptional regulator | - |
| QJQ34_RS26760 (QJQ34_26760) | 137405..137632 | + | 228 | Protein_152 | IS3 family transposase | - |
| QJQ34_RS26765 (QJQ34_26765) | 137724..139280 | - | 1557 | WP_025999314.1 | sensor domain-containing diguanylate cyclase | - |
| QJQ34_RS26770 (QJQ34_26770) | 139467..139640 | - | 174 | Protein_154 | nuclease | - |
| QJQ34_RS26775 (QJQ34_26775) | 139693..140229 | - | 537 | Protein_155 | integrase core domain-containing protein | - |
| QJQ34_RS26780 (QJQ34_26780) | 140288..141256 | - | 969 | WP_102097429.1 | IS5 family transposase | - |
| QJQ34_RS26785 (QJQ34_26785) | 141274..141699 | - | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJQ34_RS26790 (QJQ34_26790) | 141696..141926 | - | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJQ34_RS26795 (QJQ34_26795) | 142182..144758 | - | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA1 / tet(D) / blaSHV-12 | - | 1..254179 | 254179 | |
| - | flank | IS/Tn | - | - | 140288..141256 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T281120 WP_017901321.1 NZ_CP124703:c141699-141274 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |