Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4635311..4636121 | Replicon | chromosome |
| Accession | NZ_CP124702 | ||
| Organism | Klebsiella pneumoniae strain KP21315 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A332NV98 |
| Locus tag | QJQ34_RS22965 | Protein ID | WP_014908042.1 |
| Coordinates | 4635311..4635844 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | QJQ34_RS22970 | Protein ID | WP_023343051.1 |
| Coordinates | 4635855..4636121 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ34_RS22960 (4634142) | 4634142..4635263 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
| QJQ34_RS22965 (4635311) | 4635311..4635844 | - | 534 | WP_014908042.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| QJQ34_RS22970 (4635855) | 4635855..4636121 | - | 267 | WP_023343051.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| QJQ34_RS22975 (4636224) | 4636224..4637657 | - | 1434 | WP_023343050.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| QJQ34_RS22980 (4637647) | 4637647..4638330 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| QJQ34_RS22985 (4638503) | 4638503..4639888 | + | 1386 | WP_024623207.1 | efflux transporter outer membrane subunit | - |
| QJQ34_RS22990 (4639906) | 4639906..4640250 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T281114 WP_014908042.1 NZ_CP124702:c4635844-4635311 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|