Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4203402..4204108 | Replicon | chromosome |
Accession | NZ_CP124702 | ||
Organism | Klebsiella pneumoniae strain KP21315 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | QJQ34_RS20920 | Protein ID | WP_024622903.1 |
Coordinates | 4203740..4204108 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
Locus tag | QJQ34_RS20915 | Protein ID | WP_023302278.1 |
Coordinates | 4203402..4203719 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ34_RS20870 (4198543) | 4198543..4199367 | + | 825 | WP_023302271.1 | DUF932 domain-containing protein | - |
QJQ34_RS20875 (4199576) | 4199576..4200286 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
QJQ34_RS20880 (4200312) | 4200312..4200848 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
QJQ34_RS20885 (4200890) | 4200890..4201327 | + | 438 | WP_023301392.1 | hypothetical protein | - |
QJQ34_RS20890 (4201394) | 4201394..4201804 | + | 411 | WP_023302274.1 | hypothetical protein | - |
QJQ34_RS20895 (4201882) | 4201882..4202118 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
QJQ34_RS20900 (4202205) | 4202205..4202663 | + | 459 | WP_023302275.1 | antirestriction protein | - |
QJQ34_RS20905 (4202672) | 4202672..4203154 | + | 483 | WP_023302276.1 | RadC family protein | - |
QJQ34_RS20910 (4203163) | 4203163..4203384 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
QJQ34_RS20915 (4203402) | 4203402..4203719 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJQ34_RS20920 (4203740) | 4203740..4204108 | + | 369 | WP_024622903.1 | TA system toxin CbtA family protein | Toxin |
QJQ34_RS20925 (4204192) | 4204192..4204446 | + | 255 | WP_123618874.1 | hypothetical protein | - |
QJQ34_RS20930 (4204569) | 4204569..4207214 | - | 2646 | WP_024622905.1 | LuxR C-terminal-related transcriptional regulator | - |
QJQ34_RS20935 (4207588) | 4207588..4208547 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13651.82 Da Isoelectric Point: 7.2897
>T281113 WP_024622903.1 NZ_CP124702:4203740-4204108 [Klebsiella pneumoniae]
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|