Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4024593..4025212 Replicon chromosome
Accession NZ_CP124702
Organism Klebsiella pneumoniae strain KP21315

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJQ34_RS19985 Protein ID WP_002892050.1
Coordinates 4024994..4025212 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJQ34_RS19980 Protein ID WP_002892066.1
Coordinates 4024593..4024967 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ34_RS19970 (4019745) 4019745..4020938 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJQ34_RS19975 (4020961) 4020961..4024107 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QJQ34_RS19980 (4024593) 4024593..4024967 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJQ34_RS19985 (4024994) 4024994..4025212 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJQ34_RS19990 (4025371) 4025371..4025937 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJQ34_RS19995 (4025909) 4025909..4026049 - 141 WP_004147370.1 hypothetical protein -
QJQ34_RS20000 (4026070) 4026070..4026540 + 471 WP_002892026.1 YlaC family protein -
QJQ34_RS20005 (4026515) 4026515..4027966 - 1452 WP_023302231.1 PLP-dependent aminotransferase family protein -
QJQ34_RS20010 (4028067) 4028067..4028765 + 699 WP_002892021.1 GNAT family protein -
QJQ34_RS20015 (4028762) 4028762..4028902 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJQ34_RS20020 (4028902) 4028902..4029165 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281112 WP_002892050.1 NZ_CP124702:4024994-4025212 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281112 WP_002892066.1 NZ_CP124702:4024593-4024967 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References