Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 15538..16063 | Replicon | plasmid p2-KP21317 |
Accession | NZ_CP124700 | ||
Organism | Klebsiella pneumoniae strain KP21317 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | QJQ33_RS27560 | Protein ID | WP_013023785.1 |
Coordinates | 15758..16063 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | QJQ33_RS27555 | Protein ID | WP_001568025.1 |
Coordinates | 15538..15756 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ33_RS27535 (QJQ33_27535) | 10694..11473 | + | 780 | WP_013023780.1 | hypothetical protein | - |
QJQ33_RS27540 (QJQ33_27540) | 11680..13272 | + | 1593 | WP_015344964.1 | hypothetical protein | - |
QJQ33_RS27545 (QJQ33_27545) | 13306..14433 | + | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
QJQ33_RS27550 (QJQ33_27550) | 14430..14720 | + | 291 | WP_013023783.1 | hypothetical protein | - |
QJQ33_RS27555 (QJQ33_27555) | 15538..15756 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJQ33_RS27560 (QJQ33_27560) | 15758..16063 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJQ33_RS27565 (QJQ33_27565) | 16232..16627 | + | 396 | WP_017899885.1 | hypothetical protein | - |
QJQ33_RS27570 (QJQ33_27570) | 16654..16968 | + | 315 | WP_053389906.1 | hypothetical protein | - |
QJQ33_RS27575 (QJQ33_27575) | 16979..17995 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
QJQ33_RS27580 (QJQ33_27580) | 18193..18987 | + | 795 | WP_004197635.1 | site-specific integrase | - |
QJQ33_RS27585 (QJQ33_27585) | 19419..19721 | - | 303 | WP_004197636.1 | hypothetical protein | - |
QJQ33_RS27590 (QJQ33_27590) | 19718..20344 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..93119 | 93119 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T281102 WP_013023785.1 NZ_CP124700:15758-16063 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |