Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 49203..49939 | Replicon | plasmid p1-KP21317 |
| Accession | NZ_CP124699 | ||
| Organism | Klebsiella pneumoniae strain KP21317 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | QJQ33_RS26910 | Protein ID | WP_003026803.1 |
| Coordinates | 49457..49939 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QJQ33_RS26905 | Protein ID | WP_003026799.1 |
| Coordinates | 49203..49469 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ33_RS26885 (QJQ33_26885) | 44938..45156 | - | 219 | Protein_44 | transposase | - |
| QJQ33_RS26890 (QJQ33_26890) | 45369..45878 | + | 510 | WP_049183345.1 | SMI1/KNR4 family protein | - |
| QJQ33_RS26895 (QJQ33_26895) | 45901..47568 | + | 1668 | WP_049183348.1 | hypothetical protein | - |
| QJQ33_RS26900 (QJQ33_26900) | 47582..48781 | + | 1200 | WP_013609503.1 | hypothetical protein | - |
| QJQ33_RS26905 (QJQ33_26905) | 49203..49469 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QJQ33_RS26910 (QJQ33_26910) | 49457..49939 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| QJQ33_RS26915 (QJQ33_26915) | 50140..51543 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| QJQ33_RS26920 (QJQ33_26920) | 51572..52204 | - | 633 | WP_059689567.1 | hypothetical protein | - |
| QJQ33_RS26925 (QJQ33_26925) | 52381..53546 | - | 1166 | Protein_52 | IS3 family transposase | - |
| QJQ33_RS26930 (QJQ33_26930) | 53723..54685 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..144264 | 144264 | |
| - | inside | IScluster/Tn | - | - | 41847..53408 | 11561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T281101 WP_003026803.1 NZ_CP124699:49457-49939 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |