Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14843..15486 Replicon plasmid p1-KP21317
Accession NZ_CP124699
Organism Klebsiella pneumoniae strain KP21317

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QJQ33_RS26745 Protein ID WP_001044770.1
Coordinates 15070..15486 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QJQ33_RS26740 Protein ID WP_001261282.1
Coordinates 14843..15073 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ33_RS26710 (QJQ33_26710) 10082..10810 + 729 Protein_9 CSS-motif domain-containing protein -
QJQ33_RS26715 (QJQ33_26715) 10862..11662 + 801 WP_049183813.1 EAL domain-containing protein -
QJQ33_RS26720 (QJQ33_26720) 12410..13441 + 1032 WP_004176137.1 IS630-like element ISEc33 family transposase -
QJQ33_RS26725 (QJQ33_26725) 13447..13881 - 435 WP_225556700.1 hypothetical protein -
QJQ33_RS26730 (QJQ33_26730) 13933..14283 - 351 WP_023328272.1 hypothetical protein -
QJQ33_RS26735 (QJQ33_26735) 14472..14886 - 415 Protein_14 hypothetical protein -
QJQ33_RS26740 (QJQ33_26740) 14843..15073 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJQ33_RS26745 (QJQ33_26745) 15070..15486 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QJQ33_RS26750 (QJQ33_26750) 15560..17122 + 1563 WP_004206609.1 AAA family ATPase -
QJQ33_RS26755 (QJQ33_26755) 17107..18129 + 1023 WP_000361404.1 helicase UvrD -
QJQ33_RS26760 (QJQ33_26760) 18673..19581 + 909 WP_032411229.1 HNH endonuclease -
QJQ33_RS26765 (QJQ33_26765) 19767..20117 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..144264 144264
- flank IS/Tn - - 12410..13441 1031


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T281100 WP_001044770.1 NZ_CP124699:15070-15486 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT281100 WP_001261282.1 NZ_CP124699:14843-15073 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References