Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4939120..4939636 | Replicon | chromosome |
| Accession | NZ_CP124698 | ||
| Organism | Klebsiella pneumoniae strain KP21317 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | QJQ33_RS24070 | Protein ID | WP_004178374.1 |
| Coordinates | 4939120..4939404 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QJQ33_RS24075 | Protein ID | WP_002886901.1 |
| Coordinates | 4939394..4939636 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ33_RS24045 (4934604) | 4934604..4934867 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
| QJQ33_RS24050 (4934997) | 4934997..4935170 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| QJQ33_RS24055 (4935173) | 4935173..4935916 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QJQ33_RS24060 (4936273) | 4936273..4938411 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QJQ33_RS24065 (4938652) | 4938652..4939116 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QJQ33_RS24070 (4939120) | 4939120..4939404 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJQ33_RS24075 (4939394) | 4939394..4939636 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QJQ33_RS24080 (4939714) | 4939714..4941624 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
| QJQ33_RS24085 (4941647) | 4941647..4942801 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| QJQ33_RS24090 (4942868) | 4942868..4943608 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T281097 WP_004178374.1 NZ_CP124698:c4939404-4939120 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |