Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4849642..4850468 Replicon chromosome
Accession NZ_CP124698
Organism Klebsiella pneumoniae strain KP21317

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QJQ33_RS23700 Protein ID WP_000854683.1
Coordinates 4849642..4850016 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QJQ33_RS23705 Protein ID WP_024186744.1
Coordinates 4850106..4850468 (-) Length 121 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ33_RS23660 (4844912) 4844912..4845178 + 267 WP_004178415.1 hypothetical protein -
QJQ33_RS23665 (4845178) 4845178..4845850 + 673 Protein_4640 DUF4400 domain-containing protein -
QJQ33_RS23670 (4845861) 4845861..4846577 + 717 WP_004178413.1 RES domain-containing protein -
QJQ33_RS23675 (4846945) 4846945..4847133 - 189 Protein_4642 transposase -
QJQ33_RS23680 (4847150) 4847150..4848261 - 1112 Protein_4643 IS3 family transposase -
QJQ33_RS23685 (4848711) 4848711..4848860 - 150 Protein_4644 hypothetical protein -
QJQ33_RS23690 (4848945) 4848945..4849187 - 243 WP_074420605.1 DUF957 domain-containing protein -
QJQ33_RS23695 (4849154) 4849154..4849645 - 492 WP_000976831.1 DUF5983 family protein -
QJQ33_RS23700 (4849642) 4849642..4850016 - 375 WP_000854683.1 TA system toxin CbtA family protein Toxin
QJQ33_RS23705 (4850106) 4850106..4850468 - 363 WP_024186744.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJQ33_RS23710 (4850547) 4850547..4850768 - 222 WP_000692312.1 DUF987 domain-containing protein -
QJQ33_RS23715 (4850837) 4850837..4851313 - 477 WP_001186708.1 RadC family protein -
QJQ33_RS23720 (4851329) 4851329..4851814 - 486 WP_000206667.1 antirestriction protein -
QJQ33_RS23725 (4851906) 4851906..4852724 - 819 WP_001234592.1 DUF932 domain-containing protein -
QJQ33_RS23730 (4853064) 4853064..4854134 - 1071 WP_000102675.1 patatin-like phospholipase family protein -
QJQ33_RS23735 (4854131) 4854131..4855036 - 906 WP_000203561.1 diguanylate cyclase regulator RdcB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(16-115)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13993.03 Da        Isoelectric Point: 8.2905

>T281096 WP_000854683.1 NZ_CP124698:c4850016-4849642 [Klebsiella pneumoniae]
MKTLPDTHIREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTQFADERVIELHIEAGISLCDAVNFLVEKYALVRTGQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 121 a.a.        Molecular weight: 13354.17 Da        Isoelectric Point: 6.6247

>AT281096 WP_024186744.1 NZ_CP124698:c4850468-4850106 [Klebsiella pneumoniae]
VSDTLPGTTHPDNNRPWWGLPCTVMPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSGEL
NPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTSETKK

Download         Length: 363 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References