Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4198726..4199345 Replicon chromosome
Accession NZ_CP124698
Organism Klebsiella pneumoniae strain KP21317

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJQ33_RS20530 Protein ID WP_002892050.1
Coordinates 4199127..4199345 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJQ33_RS20525 Protein ID WP_002892066.1
Coordinates 4198726..4199100 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ33_RS20515 (4193878) 4193878..4195071 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJQ33_RS20520 (4195094) 4195094..4198240 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QJQ33_RS20525 (4198726) 4198726..4199100 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJQ33_RS20530 (4199127) 4199127..4199345 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJQ33_RS20535 (4199504) 4199504..4200070 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJQ33_RS20540 (4200042) 4200042..4200182 - 141 WP_004147370.1 hypothetical protein -
QJQ33_RS20545 (4200203) 4200203..4200673 + 471 WP_002892026.1 YlaC family protein -
QJQ33_RS20550 (4200648) 4200648..4202099 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QJQ33_RS20555 (4202200) 4202200..4202898 + 699 WP_004178762.1 GNAT family protein -
QJQ33_RS20560 (4202895) 4202895..4203035 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJQ33_RS20565 (4203035) 4203035..4203298 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281094 WP_002892050.1 NZ_CP124698:4199127-4199345 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281094 WP_002892066.1 NZ_CP124698:4198726-4199100 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References