Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 791177..791834 | Replicon | chromosome |
| Accession | NZ_CP124698 | ||
| Organism | Klebsiella pneumoniae strain KP21317 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QJQ33_RS03910 | Protein ID | WP_004181233.1 |
| Coordinates | 791424..791834 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | QJQ33_RS03905 | Protein ID | WP_002916312.1 |
| Coordinates | 791177..791443 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ33_RS03880 (786333) | 786333..787766 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
| QJQ33_RS03885 (787885) | 787885..788613 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| QJQ33_RS03890 (788663) | 788663..788974 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| QJQ33_RS03895 (789138) | 789138..789797 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| QJQ33_RS03900 (789948) | 789948..790931 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| QJQ33_RS03905 (791177) | 791177..791443 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| QJQ33_RS03910 (791424) | 791424..791834 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
| QJQ33_RS03915 (791841) | 791841..792362 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| QJQ33_RS03920 (792463) | 792463..793359 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| QJQ33_RS03925 (793382) | 793382..794095 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QJQ33_RS03930 (794101) | 794101..795834 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T281087 WP_004181233.1 NZ_CP124698:791424-791834 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|