Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21208..21851 | Replicon | plasmid p4-KP21300 |
Accession | NZ_CP124697 | ||
Organism | Klebsiella pneumoniae strain KP21300 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A7D6UII7 |
Locus tag | QJQ26_RS28750 | Protein ID | WP_032425563.1 |
Coordinates | 21208..21624 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | QJQ26_RS28755 | Protein ID | WP_001261276.1 |
Coordinates | 21621..21851 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ26_RS28735 (QJQ26_28735) | 16252..18360 | - | 2109 | WP_214603304.1 | peptidase domain-containing ABC transporter | - |
QJQ26_RS28740 (QJQ26_28740) | 18350..19627 | - | 1278 | WP_009309915.1 | HlyD family secretion protein | - |
QJQ26_RS28745 (QJQ26_28745) | 20289..21167 | + | 879 | WP_064182004.1 | restriction endonuclease | - |
QJQ26_RS28750 (QJQ26_28750) | 21208..21624 | - | 417 | WP_032425563.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QJQ26_RS28755 (QJQ26_28755) | 21621..21851 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QJQ26_RS28760 (QJQ26_28760) | 22422..22772 | + | 351 | WP_000493378.1 | hypothetical protein | - |
QJQ26_RS28765 (QJQ26_28765) | 22823..23566 | + | 744 | WP_000129823.1 | hypothetical protein | - |
QJQ26_RS28770 (QJQ26_28770) | 23563..24339 | + | 777 | WP_000015958.1 | site-specific integrase | - |
QJQ26_RS28775 (QJQ26_28775) | 24397..24654 | - | 258 | WP_000764642.1 | hypothetical protein | - |
QJQ26_RS28780 (QJQ26_28780) | 24783..24887 | - | 105 | WP_032409716.1 | hypothetical protein | - |
QJQ26_RS28785 (QJQ26_28785) | 25422..26288 | + | 867 | WP_004118283.1 | replication initiation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | qnrS1 / dfrA14 / tet(D) | - | 1..62484 | 62484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.56 Da Isoelectric Point: 8.5403
>T281085 WP_032425563.1 NZ_CP124697:c21624-21208 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D6UII7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |