Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 15450..15975 | Replicon | plasmid p3-KP21300 |
| Accession | NZ_CP124696 | ||
| Organism | Klebsiella pneumoniae strain KP21300 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | QJQ26_RS28115 | Protein ID | WP_013023785.1 |
| Coordinates | 15670..15975 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | QJQ26_RS28110 | Protein ID | WP_001568025.1 |
| Coordinates | 15450..15668 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ26_RS28090 (QJQ26_28090) | 10606..11385 | + | 780 | WP_013023780.1 | hypothetical protein | - |
| QJQ26_RS28095 (QJQ26_28095) | 11661..13184 | + | 1524 | WP_017899887.1 | hypothetical protein | - |
| QJQ26_RS28100 (QJQ26_28100) | 13218..14345 | + | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
| QJQ26_RS28105 (QJQ26_28105) | 14342..14632 | + | 291 | WP_013023783.1 | hypothetical protein | - |
| QJQ26_RS28110 (QJQ26_28110) | 15450..15668 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJQ26_RS28115 (QJQ26_28115) | 15670..15975 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJQ26_RS28120 (QJQ26_28120) | 16144..16539 | + | 396 | WP_017899885.1 | hypothetical protein | - |
| QJQ26_RS28125 (QJQ26_28125) | 16566..16880 | + | 315 | WP_053389906.1 | hypothetical protein | - |
| QJQ26_RS28130 (QJQ26_28130) | 16891..17907 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
| QJQ26_RS28135 (QJQ26_28135) | 18105..18899 | + | 795 | WP_004197635.1 | site-specific integrase | - |
| QJQ26_RS28140 (QJQ26_28140) | 19331..19633 | - | 303 | WP_004197636.1 | hypothetical protein | - |
| QJQ26_RS28145 (QJQ26_28145) | 19630..20256 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..96675 | 96675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T281083 WP_013023785.1 NZ_CP124696:15670-15975 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |