Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3991104..3991723 | Replicon | chromosome |
| Accession | NZ_CP124693 | ||
| Organism | Klebsiella pneumoniae strain KP21300 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QJQ26_RS19555 | Protein ID | WP_002892050.1 |
| Coordinates | 3991505..3991723 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | QJQ26_RS19550 | Protein ID | WP_002892066.1 |
| Coordinates | 3991104..3991478 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ26_RS19540 (3986256) | 3986256..3987449 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJQ26_RS19545 (3987472) | 3987472..3990618 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QJQ26_RS19550 (3991104) | 3991104..3991478 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| QJQ26_RS19555 (3991505) | 3991505..3991723 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QJQ26_RS19560 (3991882) | 3991882..3992448 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| QJQ26_RS19565 (3992420) | 3992420..3992560 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| QJQ26_RS19570 (3992581) | 3992581..3993051 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| QJQ26_RS19575 (3993026) | 3993026..3994477 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| QJQ26_RS19580 (3994578) | 3994578..3995276 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| QJQ26_RS19585 (3995273) | 3995273..3995413 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QJQ26_RS19590 (3995413) | 3995413..3995676 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281078 WP_002892050.1 NZ_CP124693:3991505-3991723 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT281078 WP_002892066.1 NZ_CP124693:3991104-3991478 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |