Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3991104..3991723 Replicon chromosome
Accession NZ_CP124693
Organism Klebsiella pneumoniae strain KP21300

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJQ26_RS19555 Protein ID WP_002892050.1
Coordinates 3991505..3991723 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJQ26_RS19550 Protein ID WP_002892066.1
Coordinates 3991104..3991478 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ26_RS19540 (3986256) 3986256..3987449 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJQ26_RS19545 (3987472) 3987472..3990618 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QJQ26_RS19550 (3991104) 3991104..3991478 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJQ26_RS19555 (3991505) 3991505..3991723 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJQ26_RS19560 (3991882) 3991882..3992448 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJQ26_RS19565 (3992420) 3992420..3992560 - 141 WP_004147370.1 hypothetical protein -
QJQ26_RS19570 (3992581) 3992581..3993051 + 471 WP_002892026.1 YlaC family protein -
QJQ26_RS19575 (3993026) 3993026..3994477 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QJQ26_RS19580 (3994578) 3994578..3995276 + 699 WP_002892021.1 GNAT family protein -
QJQ26_RS19585 (3995273) 3995273..3995413 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJQ26_RS19590 (3995413) 3995413..3995676 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281078 WP_002892050.1 NZ_CP124693:3991505-3991723 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281078 WP_002892066.1 NZ_CP124693:3991104-3991478 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References