Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1812261..1812851 | Replicon | chromosome |
| Accession | NZ_CP124693 | ||
| Organism | Klebsiella pneumoniae strain KP21300 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QJQ26_RS08870 | Protein ID | WP_023341911.1 |
| Coordinates | 1812519..1812851 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
| Locus tag | QJQ26_RS08865 | Protein ID | WP_000288812.1 |
| Coordinates | 1812261..1812518 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ26_RS08840 (1808171) | 1808171..1808245 | + | 75 | Protein_1732 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QJQ26_RS08845 (1808596) | 1808596..1810344 | + | 1749 | WP_032418698.1 | hypothetical protein | - |
| QJQ26_RS08850 (1810398) | 1810398..1810979 | + | 582 | WP_099184326.1 | hypothetical protein | - |
| QJQ26_RS08855 (1811262) | 1811262..1811723 | + | 462 | WP_004213450.1 | hypothetical protein | - |
| QJQ26_RS08860 (1811720) | 1811720..1811926 | + | 207 | WP_020805021.1 | helix-turn-helix transcriptional regulator | - |
| QJQ26_RS08865 (1812261) | 1812261..1812518 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
| QJQ26_RS08870 (1812519) | 1812519..1812851 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QJQ26_RS08880 (1813173) | 1813173..1814609 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| QJQ26_RS08890 (1814975) | 1814975..1816429 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
| QJQ26_RS08895 (1816559) | 1816559..1816804 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T281071 WP_023341911.1 NZ_CP124693:1812519-1812851 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|