Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 5309636..5310240 | Replicon | chromosome |
Accession | NZ_CP124680 | ||
Organism | Nocardioides sp. L-11A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QJ852_RS25430 | Protein ID | WP_282401730.1 |
Coordinates | 5309839..5310240 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QJ852_RS25425 | Protein ID | WP_282401729.1 |
Coordinates | 5309636..5309845 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ852_RS25415 (QJ852_25415) | 5304801..5306876 | - | 2076 | WP_282401727.1 | hypothetical protein | - |
QJ852_RS25420 (QJ852_25420) | 5307072..5309477 | - | 2406 | WP_282401728.1 | DEAD/DEAH box helicase | - |
QJ852_RS25425 (QJ852_25425) | 5309636..5309845 | + | 210 | WP_282401729.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QJ852_RS25430 (QJ852_25430) | 5309839..5310240 | + | 402 | WP_282401730.1 | PIN domain-containing protein | Toxin |
QJ852_RS25435 (QJ852_25435) | 5310698..5312326 | - | 1629 | WP_282401731.1 | helix-turn-helix transcriptional regulator | - |
QJ852_RS25440 (QJ852_25440) | 5312449..5313042 | + | 594 | WP_282401732.1 | hypothetical protein | - |
QJ852_RS25445 (QJ852_25445) | 5313097..5313678 | + | 582 | WP_282401733.1 | hypothetical protein | - |
QJ852_RS25450 (QJ852_25450) | 5313810..5314124 | - | 315 | WP_282401734.1 | DUF2470 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14760.88 Da Isoelectric Point: 4.8006
>T281067 WP_282401730.1 NZ_CP124680:5309839-5310240 [Nocardioides sp. L-11A]
VVTLVDSSAWIDYFRRPGDPGNEPLRDLIRREEVATSEPIAMELSMGPTDELAVRRIERILGSAVDLSIEADLDFRAAAA
IFRAVRRTGRTVHSTVDCLIAAIAIRHDVPLLHRDADFEAIATVTELRQLSLL
VVTLVDSSAWIDYFRRPGDPGNEPLRDLIRREEVATSEPIAMELSMGPTDELAVRRIERILGSAVDLSIEADLDFRAAAA
IFRAVRRTGRTVHSTVDCLIAAIAIRHDVPLLHRDADFEAIATVTELRQLSLL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|