Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 4355987..4356541 Replicon chromosome
Accession NZ_CP124680
Organism Nocardioides sp. L-11A

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag QJ852_RS20935 Protein ID WP_282400872.1
Coordinates 4356227..4356541 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag QJ852_RS20930 Protein ID WP_282400871.1
Coordinates 4355987..4356220 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJ852_RS20900 (QJ852_20900) 4351164..4351838 - 675 WP_282400865.1 SIMPL domain-containing protein -
QJ852_RS20905 (QJ852_20905) 4351878..4352477 - 600 WP_282400866.1 methyltransferase -
QJ852_RS20910 (QJ852_20910) 4352474..4353334 - 861 WP_282400867.1 tRNA pseudouridine(38-40) synthase TruA -
QJ852_RS20915 (QJ852_20915) 4353510..4354448 - 939 WP_282400868.1 PfkB family carbohydrate kinase -
QJ852_RS20920 (QJ852_20920) 4354477..4355724 + 1248 WP_282400869.1 exodeoxyribonuclease VII large subunit -
QJ852_RS20925 (QJ852_20925) 4355717..4355938 + 222 WP_282400870.1 exodeoxyribonuclease VII small subunit -
QJ852_RS20930 (QJ852_20930) 4355987..4356220 + 234 WP_282400871.1 ribbon-helix-helix domain-containing protein Antitoxin
QJ852_RS20935 (QJ852_20935) 4356227..4356541 + 315 WP_282400872.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QJ852_RS20940 (QJ852_20940) 4356564..4357451 - 888 WP_282400873.1 hypothetical protein -
QJ852_RS20945 (QJ852_20945) 4357481..4358062 - 582 WP_282400874.1 DUF4245 family protein -
QJ852_RS20950 (QJ852_20950) 4358174..4358584 + 411 WP_282400875.1 helix-turn-helix domain-containing protein -
QJ852_RS20955 (QJ852_20955) 4358595..4359410 + 816 WP_282400876.1 molybdate ABC transporter substrate-binding protein -
QJ852_RS20960 (QJ852_20960) 4359418..4360203 + 786 WP_282400877.1 ABC transporter permease -
QJ852_RS20965 (QJ852_20965) 4360200..4361255 + 1056 WP_282400878.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-93)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11093.90 Da        Isoelectric Point: 4.5741

>T281066 WP_282400872.1 NZ_CP124680:4356227-4356541 [Nocardioides sp. L-11A]
VREICLARLDKTRPVVVLTREAARAAMTKVSVAPITSTAKGLSSEVPVGPANGLDQECVISLDNIVTIPSDLLGRTVGFL
RDDQEPELARALVLTFDLDLPLLG

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8475.52 Da        Isoelectric Point: 4.7824

>AT281066 WP_282400871.1 NZ_CP124680:4355987-4356220 [Nocardioides sp. L-11A]
VSTQIAIRLPDDMVAFLDRRVAEGRATSRAAIVSAAIEREMRRHAAEQDAQILRARGAGDELDDLVAWSARTVTLED

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References