Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD-PIN |
Location | 2122277..2122947 | Replicon | chromosome |
Accession | NZ_CP124680 | ||
Organism | Nocardioides sp. L-11A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QJ852_RS10085 | Protein ID | WP_282404010.1 |
Coordinates | 2122277..2122663 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QJ852_RS10090 | Protein ID | WP_282404011.1 |
Coordinates | 2122660..2122947 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ852_RS10055 (QJ852_10055) | 2117345..2117749 | + | 405 | WP_282404005.1 | DUF2510 domain-containing protein | - |
QJ852_RS10060 (QJ852_10060) | 2117794..2118282 | + | 489 | WP_282404006.1 | hypothetical protein | - |
QJ852_RS10065 (QJ852_10065) | 2118269..2119618 | - | 1350 | WP_282404007.1 | recombinase family protein | - |
QJ852_RS10070 (QJ852_10070) | 2119640..2120185 | + | 546 | WP_282404641.1 | ATP-binding protein | - |
QJ852_RS10075 (QJ852_10075) | 2120182..2121330 | + | 1149 | WP_282404008.1 | DNA-processing protein DprA | - |
QJ852_RS10080 (QJ852_10080) | 2121327..2122268 | + | 942 | WP_282404009.1 | tyrosine recombinase XerC | - |
QJ852_RS10085 (QJ852_10085) | 2122277..2122663 | - | 387 | WP_282404010.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QJ852_RS10090 (QJ852_10090) | 2122660..2122947 | - | 288 | WP_282404011.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QJ852_RS10095 (QJ852_10095) | 2122944..2123549 | - | 606 | WP_282404012.1 | M23 family metallopeptidase | - |
QJ852_RS10100 (QJ852_10100) | 2123855..2124754 | + | 900 | WP_282404013.1 | 30S ribosomal protein S2 | - |
QJ852_RS10105 (QJ852_10105) | 2124797..2125606 | + | 810 | WP_282404014.1 | translation elongation factor Ts | - |
QJ852_RS10110 (QJ852_10110) | 2125847..2127067 | + | 1221 | WP_282404015.1 | SPFH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14024.99 Da Isoelectric Point: 4.6034
>T281065 WP_282404010.1 NZ_CP124680:c2122663-2122277 [Nocardioides sp. L-11A]
VNVYVDTSAVVKLIAEEAESDALRDYLNGLDPRRVFSSELLVTEVRRAAMRNDVEQSLATEVLESINLFEMTSPLLQHAG
LLPDPTLRSLDAIHLATALRHGAEVLVCYDLRLRTAAERQGLVAASPA
VNVYVDTSAVVKLIAEEAESDALRDYLNGLDPRRVFSSELLVTEVRRAAMRNDVEQSLATEVLESINLFEMTSPLLQHAG
LLPDPTLRSLDAIHLATALRHGAEVLVCYDLRLRTAAERQGLVAASPA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|