Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1747491..1748199 | Replicon | chromosome |
Accession | NZ_CP124680 | ||
Organism | Nocardioides sp. L-11A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QJ852_RS08195 | Protein ID | WP_282403654.1 |
Coordinates | 1747771..1748199 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QJ852_RS08190 | Protein ID | WP_282403653.1 |
Coordinates | 1747491..1747784 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ852_RS08175 (QJ852_08175) | 1743425..1744609 | + | 1185 | WP_282403650.1 | homogentisate 1,2-dioxygenase | - |
QJ852_RS08180 (QJ852_08180) | 1744613..1745656 | - | 1044 | WP_282403651.1 | crosslink repair DNA glycosylase YcaQ family protein | - |
QJ852_RS08185 (QJ852_08185) | 1745676..1747346 | - | 1671 | WP_282403652.1 | DUF885 domain-containing protein | - |
QJ852_RS08190 (QJ852_08190) | 1747491..1747784 | + | 294 | WP_282403653.1 | CopG family transcriptional regulator | Antitoxin |
QJ852_RS08195 (QJ852_08195) | 1747771..1748199 | + | 429 | WP_282403654.1 | PIN domain-containing protein | Toxin |
QJ852_RS08200 (QJ852_08200) | 1748200..1749156 | - | 957 | WP_282403655.1 | WYL domain-containing protein | - |
QJ852_RS08205 (QJ852_08205) | 1749211..1750323 | + | 1113 | WP_282403656.1 | epoxide hydrolase | - |
QJ852_RS08210 (QJ852_08210) | 1750359..1751069 | - | 711 | WP_282403657.1 | maleylpyruvate isomerase family mycothiol-dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.89 Da Isoelectric Point: 5.9654
>T281064 WP_282403654.1 NZ_CP124680:1747771-1748199 [Nocardioides sp. L-11A]
MNVLDVNVVIPLYRGDHSHHAAATAWWQQSVTAGETFTVPDLVWVGFVRMITNRRVFPEPSAFRDAWEFAAALMAQPTYT
TWTAHPRTLEEFTALSAQAGARADLVTDAYIAACAATYGGTVVTFDRDFRKFDGLRVHELTL
MNVLDVNVVIPLYRGDHSHHAAATAWWQQSVTAGETFTVPDLVWVGFVRMITNRRVFPEPSAFRDAWEFAAALMAQPTYT
TWTAHPRTLEEFTALSAQAGARADLVTDAYIAACAATYGGTVVTFDRDFRKFDGLRVHELTL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|