Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1564829..1565460 | Replicon | chromosome |
Accession | NZ_CP124680 | ||
Organism | Nocardioides sp. L-11A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QJ852_RS07345 | Protein ID | WP_282403487.1 |
Coordinates | 1564829..1565230 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QJ852_RS07350 | Protein ID | WP_282403488.1 |
Coordinates | 1565227..1565460 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ852_RS07320 (QJ852_07320) | 1560412..1561458 | - | 1047 | WP_282403482.1 | hypothetical protein | - |
QJ852_RS07325 (QJ852_07325) | 1561458..1561970 | - | 513 | WP_282403483.1 | hypothetical protein | - |
QJ852_RS07330 (QJ852_07330) | 1561954..1562865 | - | 912 | WP_282403484.1 | DUF58 domain-containing protein | - |
QJ852_RS07335 (QJ852_07335) | 1562873..1563931 | - | 1059 | WP_282403485.1 | MoxR family ATPase | - |
QJ852_RS07340 (QJ852_07340) | 1563993..1564799 | - | 807 | WP_282403486.1 | RDD family protein | - |
QJ852_RS07345 (QJ852_07345) | 1564829..1565230 | - | 402 | WP_282403487.1 | PIN domain-containing protein | Toxin |
QJ852_RS07350 (QJ852_07350) | 1565227..1565460 | - | 234 | WP_282403488.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QJ852_RS07355 (QJ852_07355) | 1565549..1566553 | + | 1005 | WP_282403489.1 | stage II sporulation protein M | - |
QJ852_RS07360 (QJ852_07360) | 1566586..1567941 | + | 1356 | WP_282403490.1 | FAD-dependent oxidoreductase | - |
QJ852_RS07365 (QJ852_07365) | 1568010..1568723 | + | 714 | WP_282403491.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14741.72 Da Isoelectric Point: 7.4070
>T281063 WP_282403487.1 NZ_CP124680:c1565230-1564829 [Nocardioides sp. L-11A]
MNPRHRHLLDTDVAIELLRKRDVALREAWRAAGRVAASSVSLFELRFGAARSAEPARNDLAVDELAAAVDFLDFDAEAAA
HAGDIRADLARLGTPIGAYDVMIAGHARSRGLIVVTRNEREFRRVDGLRVERW
MNPRHRHLLDTDVAIELLRKRDVALREAWRAAGRVAASSVSLFELRFGAARSAEPARNDLAVDELAAAVDFLDFDAEAAA
HAGDIRADLARLGTPIGAYDVMIAGHARSRGLIVVTRNEREFRRVDGLRVERW
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|