Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 141541..142046 | Replicon | chromosome |
| Accession | NZ_CP124670 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01536 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | QJ974_RS00645 | Protein ID | WP_003083773.1 |
| Coordinates | 141541..141822 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | QJ974_RS00650 | Protein ID | WP_003083775.1 |
| Coordinates | 141819..142046 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJ974_RS00620 (QJ974_00620) | 136792..138141 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| QJ974_RS00625 (QJ974_00625) | 138190..138876 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| QJ974_RS00630 (QJ974_00630) | 138977..139711 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| QJ974_RS00635 (QJ974_00635) | 139891..140301 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| QJ974_RS00640 (QJ974_00640) | 140333..141241 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| QJ974_RS00645 (QJ974_00645) | 141541..141822 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| QJ974_RS00650 (QJ974_00650) | 141819..142046 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QJ974_RS00655 (QJ974_00655) | 142222..142842 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| QJ974_RS00660 (QJ974_00660) | 142943..143443 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| QJ974_RS00665 (QJ974_00665) | 143516..143857 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| QJ974_RS00670 (QJ974_00670) | 143939..145366 | - | 1428 | WP_003083784.1 | GABA permease | - |
| QJ974_RS00675 (QJ974_00675) | 145535..147028 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T281058 WP_003083773.1 NZ_CP124670:c141822-141541 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|