Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5286067..5286681 Replicon chromosome
Accession NZ_CP124667
Organism Pseudomonas aeruginosa strain 2021CK-01315

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag QKA52_RS24760 Protein ID WP_071534354.1
Coordinates 5286499..5286681 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag QKA52_RS24755 Protein ID WP_012077229.1
Coordinates 5286067..5286471 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKA52_RS24730 (QKA52_24730) 5282207..5282917 + 711 WP_012074129.1 hypothetical protein -
QKA52_RS24735 (QKA52_24735) 5282914..5283834 + 921 WP_012074128.1 hypothetical protein -
QKA52_RS24740 (QKA52_24740) 5283831..5284370 + 540 WP_012074127.1 hypothetical protein -
QKA52_RS24745 (QKA52_24745) 5284370..5285068 + 699 WP_033896049.1 hypothetical protein -
QKA52_RS24750 (QKA52_24750) 5285053..5286024 + 972 WP_012077228.1 hypothetical protein -
QKA52_RS24755 (QKA52_24755) 5286067..5286471 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QKA52_RS24760 (QKA52_24760) 5286499..5286681 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
QKA52_RS24765 (QKA52_24765) 5287224..5288156 - 933 WP_019485801.1 ZIP family metal transporter -
QKA52_RS24770 (QKA52_24770) 5288175..5288786 - 612 WP_003098862.1 superoxide dismutase -
QKA52_RS24775 (QKA52_24775) 5288799..5289248 - 450 WP_003094369.1 hypothetical protein -
QKA52_RS24780 (QKA52_24780) 5289276..5290652 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
QKA52_RS24785 (QKA52_24785) 5290645..5291040 - 396 WP_023092853.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5249187..5286681 37494


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T281044 WP_071534354.1 NZ_CP124667:c5286681-5286499 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT281044 WP_012077229.1 NZ_CP124667:c5286471-5286067 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References