Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5286067..5286681 | Replicon | chromosome |
| Accession | NZ_CP124667 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01315 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | QKA52_RS24760 | Protein ID | WP_071534354.1 |
| Coordinates | 5286499..5286681 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | QKA52_RS24755 | Protein ID | WP_012077229.1 |
| Coordinates | 5286067..5286471 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKA52_RS24730 (QKA52_24730) | 5282207..5282917 | + | 711 | WP_012074129.1 | hypothetical protein | - |
| QKA52_RS24735 (QKA52_24735) | 5282914..5283834 | + | 921 | WP_012074128.1 | hypothetical protein | - |
| QKA52_RS24740 (QKA52_24740) | 5283831..5284370 | + | 540 | WP_012074127.1 | hypothetical protein | - |
| QKA52_RS24745 (QKA52_24745) | 5284370..5285068 | + | 699 | WP_033896049.1 | hypothetical protein | - |
| QKA52_RS24750 (QKA52_24750) | 5285053..5286024 | + | 972 | WP_012077228.1 | hypothetical protein | - |
| QKA52_RS24755 (QKA52_24755) | 5286067..5286471 | - | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QKA52_RS24760 (QKA52_24760) | 5286499..5286681 | - | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QKA52_RS24765 (QKA52_24765) | 5287224..5288156 | - | 933 | WP_019485801.1 | ZIP family metal transporter | - |
| QKA52_RS24770 (QKA52_24770) | 5288175..5288786 | - | 612 | WP_003098862.1 | superoxide dismutase | - |
| QKA52_RS24775 (QKA52_24775) | 5288799..5289248 | - | 450 | WP_003094369.1 | hypothetical protein | - |
| QKA52_RS24780 (QKA52_24780) | 5289276..5290652 | - | 1377 | WP_003098863.1 | class II fumarate hydratase FumC | - |
| QKA52_RS24785 (QKA52_24785) | 5290645..5291040 | - | 396 | WP_023092853.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5249187..5286681 | 37494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T281044 WP_071534354.1 NZ_CP124667:c5286681-5286499 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT281044 WP_012077229.1 NZ_CP124667:c5286471-5286067 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |