Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4982098..4982706 | Replicon | chromosome |
Accession | NZ_CP124667 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01315 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | QKA52_RS23280 | Protein ID | WP_003114156.1 |
Coordinates | 4982098..4982445 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A643EG04 |
Locus tag | QKA52_RS23285 | Protein ID | WP_042857565.1 |
Coordinates | 4982455..4982706 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKA52_RS23250 (QKA52_23250) | 4977518..4977730 | + | 213 | WP_275988278.1 | cysteine-rich CWC family protein | - |
QKA52_RS23255 (QKA52_23255) | 4977730..4978422 | + | 693 | WP_023104853.1 | 16S rRNA pseudouridine(516) synthase | - |
QKA52_RS23260 (QKA52_23260) | 4978558..4979601 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
QKA52_RS23265 (QKA52_23265) | 4979681..4980418 | + | 738 | WP_172773749.1 | murein L,D-transpeptidase catalytic domain family protein | - |
QKA52_RS23270 (QKA52_23270) | 4980870..4981772 | + | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
QKA52_RS23280 (QKA52_23280) | 4982098..4982445 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QKA52_RS23285 (QKA52_23285) | 4982455..4982706 | - | 252 | WP_042857565.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QKA52_RS23290 (QKA52_23290) | 4982920..4983903 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
QKA52_RS23295 (QKA52_23295) | 4983903..4985195 | - | 1293 | WP_003454977.1 | hypothetical protein | - |
QKA52_RS23300 (QKA52_23300) | 4985454..4986716 | - | 1263 | WP_282414015.1 | zonular occludens toxin domain-containing protein | - |
QKA52_RS23305 (QKA52_23305) | 4986718..4987068 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4982098..5002623 | 20525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T281043 WP_003114156.1 NZ_CP124667:c4982445-4982098 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A643EG04 |