Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4855129..4855737 | Replicon | chromosome |
Accession | NZ_CP124664 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01256 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | QJ960_RS22635 | Protein ID | WP_033979326.1 |
Coordinates | 4855129..4855476 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | QJ960_RS22640 | Protein ID | WP_003114155.1 |
Coordinates | 4855486..4855737 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ960_RS22605 (QJ960_22605) | 4850548..4850760 | + | 213 | WP_034047704.1 | cysteine-rich CWC family protein | - |
QJ960_RS22610 (QJ960_22610) | 4850760..4851452 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
QJ960_RS22615 (QJ960_22615) | 4851588..4852631 | + | 1044 | WP_003110811.1 | L,D-transpeptidase | - |
QJ960_RS22620 (QJ960_22620) | 4852711..4853448 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
QJ960_RS22625 (QJ960_22625) | 4853900..4854802 | + | 903 | WP_034047702.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
QJ960_RS22635 (QJ960_22635) | 4855129..4855476 | - | 348 | WP_033979326.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJ960_RS22640 (QJ960_22640) | 4855486..4855737 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QJ960_RS22645 (QJ960_22645) | 4855951..4856934 | - | 984 | WP_100212559.1 | tyrosine-type recombinase/integrase | - |
QJ960_RS22650 (QJ960_22650) | 4856934..4858226 | - | 1293 | WP_100212560.1 | hypothetical protein | - |
QJ960_RS22655 (QJ960_22655) | 4858485..4859747 | - | 1263 | WP_121410774.1 | zonular occludens toxin domain-containing protein | - |
QJ960_RS22660 (QJ960_22660) | 4859749..4860099 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4855129..4877943 | 22814 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13018.79 Da Isoelectric Point: 4.4212
>T281024 WP_033979326.1 NZ_CP124664:c4855476-4855129 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|