Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5843407..5843993 | Replicon | chromosome |
Accession | NZ_CP124662 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01633 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I91_RS27690 | Protein ID | WP_003120987.1 |
Coordinates | 5843694..5843993 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I91_RS27685 | Protein ID | WP_003448662.1 |
Coordinates | 5843407..5843697 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I91_RS27670 (P7I91_27670) | 5838982..5840877 | + | 1896 | WP_155713823.1 | hypothetical protein | - |
P7I91_RS27675 (P7I91_27675) | 5840874..5842850 | + | 1977 | WP_023093671.1 | DEAD/DEAH box helicase | - |
P7I91_RS27680 (P7I91_27680) | 5842989..5843324 | + | 336 | WP_022579623.1 | hypothetical protein | - |
P7I91_RS27685 (P7I91_27685) | 5843407..5843697 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I91_RS27690 (P7I91_27690) | 5843694..5843993 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I91_RS27695 (P7I91_27695) | 5844195..5845319 | + | 1125 | WP_023093672.1 | TcpQ domain-containing protein | - |
P7I91_RS27700 (P7I91_27700) | 5845319..5847028 | + | 1710 | WP_023093673.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I91_RS27705 (P7I91_27705) | 5847032..5848357 | + | 1326 | WP_022579625.1 | type 4b pilus protein PilO2 | - |
P7I91_RS27710 (P7I91_27710) | 5848347..5848880 | + | 534 | WP_003149521.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5812908..5901081 | 88173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T281010 WP_003120987.1 NZ_CP124662:c5843993-5843694 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|