Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5054804..5055390 | Replicon | chromosome |
Accession | NZ_CP124662 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01633 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I91_RS23685 | Protein ID | WP_003120987.1 |
Coordinates | 5055091..5055390 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I91_RS23680 | Protein ID | WP_003448662.1 |
Coordinates | 5054804..5055094 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I91_RS23660 (P7I91_23660) | 5050386..5052275 | + | 1890 | WP_003448700.1 | hypothetical protein | - |
P7I91_RS23665 (P7I91_23665) | 5052272..5054248 | + | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
P7I91_RS23670 (P7I91_23670) | 5054258..5054392 | + | 135 | WP_033179080.1 | hypothetical protein | - |
P7I91_RS23675 (P7I91_23675) | 5054389..5054733 | + | 345 | WP_003448665.1 | hypothetical protein | - |
P7I91_RS23680 (P7I91_23680) | 5054804..5055094 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I91_RS23685 (P7I91_23685) | 5055091..5055390 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I91_RS23690 (P7I91_23690) | 5055592..5056713 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
P7I91_RS23695 (P7I91_23695) | 5056713..5058422 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I91_RS23700 (P7I91_23700) | 5058426..5059751 | + | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
P7I91_RS23705 (P7I91_23705) | 5059741..5060274 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5026641..5108186 | 81545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T281009 WP_003120987.1 NZ_CP124662:c5055390-5055091 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|