Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 2620097..2620650 | Replicon | chromosome |
Accession | NZ_CP124662 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01633 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | P7I91_RS12355 | Protein ID | WP_010953434.1 |
Coordinates | 2620357..2620650 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A431XAN4 |
Locus tag | P7I91_RS12350 | Protein ID | WP_003155922.1 |
Coordinates | 2620097..2620369 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I91_RS12345 (P7I91_12345) | 2619728..2619973 | + | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
P7I91_RS12350 (P7I91_12350) | 2620097..2620369 | + | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I91_RS12355 (P7I91_12355) | 2620357..2620650 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I91_RS12360 (P7I91_12360) | 2620644..2622053 | - | 1410 | WP_034065764.1 | site-specific integrase | - |
P7I91_RS12365 (P7I91_12365) | 2622470..2623171 | - | 702 | WP_031640384.1 | hypothetical protein | - |
P7I91_RS12370 (P7I91_12370) | 2623287..2623433 | + | 147 | Protein_2443 | DNA binding protein | - |
P7I91_RS12375 (P7I91_12375) | 2623561..2625351 | - | 1791 | WP_023095445.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2585771..2629476 | 43705 | |
- | inside | Genomic island | - | - | 2584851..2629476 | 44625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T281006 WP_010953434.1 NZ_CP124662:2620357-2620650 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A431XAN4 |