Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2980244..2981286 Replicon chromosome
Accession NZ_CP124660
Organism Pseudomonas aeruginosa strain 2022CK-00160

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag P7I96_RS14370 Protein ID WP_003153636.1
Coordinates 2980711..2981286 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag P7I96_RS14365 Protein ID WP_003050245.1
Coordinates 2980244..2980714 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I96_RS14330 (P7I96_14330) 2975636..2977054 - 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -
P7I96_RS14335 (P7I96_14335) 2977044..2977955 - 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
P7I96_RS14340 (P7I96_14340) 2977952..2978644 - 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
P7I96_RS14345 (P7I96_14345) 2978641..2979039 - 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
P7I96_RS14350 (P7I96_14350) 2979051..2979410 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
P7I96_RS14355 (P7I96_14355) 2979427..2979660 - 234 WP_003090170.1 TIGR03758 family integrating conjugative element protein -
P7I96_RS14360 (P7I96_14360) 2979657..2980040 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
P7I96_RS14365 (P7I96_14365) 2980244..2980714 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
P7I96_RS14370 (P7I96_14370) 2980711..2981286 + 576 WP_003153636.1 PIN domain-containing protein Toxin
P7I96_RS14375 (P7I96_14375) 2981304..2982218 + 915 WP_016852809.1 AAA family ATPase -
P7I96_RS14380 (P7I96_14380) 2982215..2982685 + 471 WP_003090160.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
P7I96_RS14385 (P7I96_14385) 2982682..2983182 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
P7I96_RS14390 (P7I96_14390) 2983182..2984084 + 903 WP_003090158.1 CBASS oligonucleotide cyclase -
P7I96_RS14395 (P7I96_14395) 2984123..2984848 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2905673..3027402 121729


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T280999 WP_003153636.1 NZ_CP124660:2980711-2981286 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT280999 WP_003050245.1 NZ_CP124660:2980244-2980714 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References