Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 143984..144489 | Replicon | chromosome |
| Accession | NZ_CP124660 | ||
| Organism | Pseudomonas aeruginosa strain 2022CK-00160 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | P7I96_RS00665 | Protein ID | WP_003121619.1 |
| Coordinates | 143984..144265 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | P7I96_RS00670 | Protein ID | WP_003112628.1 |
| Coordinates | 144262..144489 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I96_RS00640 (P7I96_00640) | 139235..140584 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| P7I96_RS00645 (P7I96_00645) | 140633..141319 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| P7I96_RS00650 (P7I96_00650) | 141420..142154 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| P7I96_RS00655 (P7I96_00655) | 142334..142744 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| P7I96_RS00660 (P7I96_00660) | 142776..143684 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
| P7I96_RS00665 (P7I96_00665) | 143984..144265 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| P7I96_RS00670 (P7I96_00670) | 144262..144489 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I96_RS00675 (P7I96_00675) | 144665..145285 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| P7I96_RS00680 (P7I96_00680) | 145386..145886 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| P7I96_RS00685 (P7I96_00685) | 145959..146300 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| P7I96_RS00690 (P7I96_00690) | 146382..147809 | - | 1428 | WP_003083784.1 | GABA permease | - |
| P7I96_RS00695 (P7I96_00695) | 147978..149471 | - | 1494 | WP_043105480.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T280997 WP_003121619.1 NZ_CP124660:c144265-143984 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |