Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 131143..131836 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP124659 | ||
| Organism | Pseudomonas aeruginosa strain 2022CK-00068 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | P7I93_RS33700 | Protein ID | WP_003151133.1 |
| Coordinates | 131459..131836 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | P7I93_RS33695 | Protein ID | WP_001172026.1 |
| Coordinates | 131143..131478 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I93_RS33665 (P7I93_33665) | 126863..127363 | + | 501 | WP_000376623.1 | GNAT family N-acetyltransferase | - |
| P7I93_RS33670 (P7I93_33670) | 127332..128324 | - | 993 | WP_003107582.1 | TniB family NTP-binding protein | - |
| P7I93_RS33675 (P7I93_33675) | 128327..130006 | - | 1680 | WP_000179844.1 | DDE-type integrase/transposase/recombinase | - |
| P7I93_RS33680 (P7I93_33680) | 130086..130427 | - | 342 | WP_025999701.1 | hypothetical protein | - |
| P7I93_RS33685 (P7I93_33685) | 130443..130769 | - | 327 | WP_000091614.1 | hypothetical protein | - |
| P7I93_RS33690 (P7I93_33690) | 130793..131128 | - | 336 | WP_000741275.1 | hypothetical protein | - |
| P7I93_RS33695 (P7I93_33695) | 131143..131478 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P7I93_RS33700 (P7I93_33700) | 131459..131836 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I93_RS33705 (P7I93_33705) | 132028..132630 | + | 603 | WP_010465829.1 | recombinase family protein | - |
| P7I93_RS33710 (P7I93_33710) | 132614..135643 | + | 3030 | WP_010799689.1 | Tn3 family transposase | - |
| P7I93_RS33715 (P7I93_33715) | 135700..136464 | - | 765 | WP_001389365.1 | IS6-like element IS6100 family transposase | - |
| P7I93_RS33720 (P7I93_33720) | 136582..136650 | - | 69 | Protein_160 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib / qnrVC1 / dfrA15 / qacE / sul1 / aac(6')-Il / blaVIM-2 / aph(3')-VIa | - | 1..526642 | 526642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T280995 WP_003151133.1 NZ_CP124659:c131836-131459 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |