Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4841127..4841713 | Replicon | chromosome |
Accession | NZ_CP124658 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00068 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I93_RS22905 | Protein ID | WP_003120987.1 |
Coordinates | 4841414..4841713 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I93_RS22900 | Protein ID | WP_003448662.1 |
Coordinates | 4841127..4841417 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I93_RS22880 (P7I93_22880) | 4836278..4836487 | + | 210 | WP_003105733.1 | cold-shock protein | - |
P7I93_RS22885 (P7I93_22885) | 4836709..4838598 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
P7I93_RS22890 (P7I93_22890) | 4838595..4840571 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
P7I93_RS22895 (P7I93_22895) | 4840712..4841056 | + | 345 | WP_016851612.1 | hypothetical protein | - |
P7I93_RS22900 (P7I93_22900) | 4841127..4841417 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I93_RS22905 (P7I93_22905) | 4841414..4841713 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I93_RS22910 (P7I93_22910) | 4841915..4843036 | + | 1122 | WP_021263359.1 | TcpQ domain-containing protein | - |
P7I93_RS22915 (P7I93_22915) | 4843036..4844745 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I93_RS22920 (P7I93_22920) | 4844749..4846074 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
P7I93_RS22925 (P7I93_22925) | 4846064..4846597 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4813281..4841713 | 28432 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280993 WP_003120987.1 NZ_CP124658:c4841713-4841414 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|