Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2391713..2392755 | Replicon | chromosome |
| Accession | NZ_CP124658 | ||
| Organism | Pseudomonas aeruginosa strain 2022CK-00068 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | P7I93_RS11320 | Protein ID | WP_003109777.1 |
| Coordinates | 2392180..2392755 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | P7I93_RS11315 | Protein ID | WP_003050245.1 |
| Coordinates | 2391713..2392183 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I93_RS11280 (P7I93_11280) | 2387105..2388523 | - | 1419 | WP_031691871.1 | TIGR03752 family integrating conjugative element protein | - |
| P7I93_RS11285 (P7I93_11285) | 2388513..2389424 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
| P7I93_RS11290 (P7I93_11290) | 2389421..2390113 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
| P7I93_RS11295 (P7I93_11295) | 2390110..2390508 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
| P7I93_RS11300 (P7I93_11300) | 2390520..2390879 | - | 360 | WP_023980178.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| P7I93_RS11305 (P7I93_11305) | 2390896..2391129 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| P7I93_RS11310 (P7I93_11310) | 2391126..2391509 | - | 384 | WP_003105635.1 | RAQPRD family integrative conjugative element protein | - |
| P7I93_RS11315 (P7I93_11315) | 2391713..2392183 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| P7I93_RS11320 (P7I93_11320) | 2392180..2392755 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
| P7I93_RS11325 (P7I93_11325) | 2392773..2393687 | + | 915 | WP_003105629.1 | AAA family ATPase | - |
| P7I93_RS11330 (P7I93_11330) | 2393684..2394154 | + | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| P7I93_RS11335 (P7I93_11335) | 2394151..2394651 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| P7I93_RS11340 (P7I93_11340) | 2394651..2395553 | + | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
| P7I93_RS11345 (P7I93_11345) | 2395592..2396317 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2341779..2405042 | 63263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T280990 WP_003109777.1 NZ_CP124658:2392180-2392755 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT280990 WP_003050245.1 NZ_CP124658:2391713-2392183 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|