Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142969..143474 | Replicon | chromosome |
Accession | NZ_CP124657 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00069 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | P7I94_RS01095 | Protein ID | WP_003083773.1 |
Coordinates | 142969..143250 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | P7I94_RS01100 | Protein ID | WP_003083775.1 |
Coordinates | 143247..143474 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I94_RS01070 (P7I94_01070) | 138220..139569 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
P7I94_RS01075 (P7I94_01075) | 139618..140304 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
P7I94_RS01080 (P7I94_01080) | 140405..141139 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
P7I94_RS01085 (P7I94_01085) | 141319..141729 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I94_RS01090 (P7I94_01090) | 141761..142669 | - | 909 | Protein_131 | LysR family transcriptional regulator | - |
P7I94_RS01095 (P7I94_01095) | 142969..143250 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I94_RS01100 (P7I94_01100) | 143247..143474 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I94_RS01105 (P7I94_01105) | 143650..144270 | - | 621 | WP_003101226.1 | hypothetical protein | - |
P7I94_RS01110 (P7I94_01110) | 144371..144871 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
P7I94_RS01115 (P7I94_01115) | 144944..145285 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
P7I94_RS01120 (P7I94_01120) | 145369..146796 | - | 1428 | WP_282414928.1 | GABA permease | - |
P7I94_RS01125 (P7I94_01125) | 146965..148458 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280981 WP_003083773.1 NZ_CP124657:c143250-142969 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|