Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 4359730..4360283 | Replicon | chromosome |
Accession | NZ_CP124655 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00096 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | P7I95_RS20685 | Protein ID | WP_010953434.1 |
Coordinates | 4359730..4360023 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A431XAN4 |
Locus tag | P7I95_RS20690 | Protein ID | WP_003155922.1 |
Coordinates | 4360011..4360283 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I95_RS20665 (P7I95_20665) | 4355625..4355771 | - | 147 | Protein_4080 | DNA binding protein | - |
P7I95_RS20675 (P7I95_20675) | 4357230..4357910 | + | 681 | WP_282425990.1 | hypothetical protein | - |
P7I95_RS20680 (P7I95_20680) | 4358327..4359736 | + | 1410 | WP_034065764.1 | site-specific integrase | - |
P7I95_RS20685 (P7I95_20685) | 4359730..4360023 | - | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I95_RS20690 (P7I95_20690) | 4360011..4360283 | - | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I95_RS20695 (P7I95_20695) | 4360407..4360652 | - | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4348689..4397382 | 48693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T280977 WP_010953434.1 NZ_CP124655:c4360023-4359730 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A431XAN4 |