Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 1423051..1423637 | Replicon | chromosome |
| Accession | NZ_CP124655 | ||
| Organism | Pseudomonas aeruginosa strain 2022CK-00096 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | P7I95_RS06695 | Protein ID | WP_003120987.1 |
| Coordinates | 1423051..1423350 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | P7I95_RS06700 | Protein ID | WP_003448662.1 |
| Coordinates | 1423347..1423637 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I95_RS06675 (P7I95_06675) | 1418167..1418700 | - | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
| P7I95_RS06680 (P7I95_06680) | 1418690..1420015 | - | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
| P7I95_RS06685 (P7I95_06685) | 1420019..1421728 | - | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
| P7I95_RS06690 (P7I95_06690) | 1421728..1422849 | - | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
| P7I95_RS06695 (P7I95_06695) | 1423051..1423350 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I95_RS06700 (P7I95_06700) | 1423347..1423637 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| P7I95_RS06705 (P7I95_06705) | 1423708..1424052 | - | 345 | WP_003448665.1 | hypothetical protein | - |
| P7I95_RS06710 (P7I95_06710) | 1424049..1424183 | - | 135 | WP_033179080.1 | hypothetical protein | - |
| P7I95_RS06715 (P7I95_06715) | 1424193..1426169 | - | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
| P7I95_RS06720 (P7I95_06720) | 1426166..1428055 | - | 1890 | WP_003448700.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1370255..1451796 | 81541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280974 WP_003120987.1 NZ_CP124655:1423051-1423350 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|