Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142575..143080 | Replicon | chromosome |
Accession | NZ_CP124654 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01851 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | P7I92_RS00655 | Protein ID | WP_003083773.1 |
Coordinates | 142575..142856 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | P7I92_RS00660 | Protein ID | WP_003083775.1 |
Coordinates | 142853..143080 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I92_RS00630 (P7I92_00630) | 137826..139175 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
P7I92_RS00635 (P7I92_00635) | 139224..139910 | + | 687 | WP_096067914.1 | FadR/GntR family transcriptional regulator | - |
P7I92_RS00640 (P7I92_00640) | 140011..140745 | + | 735 | WP_003128333.1 | GntR family transcriptional regulator | - |
P7I92_RS00645 (P7I92_00645) | 140925..141335 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I92_RS00650 (P7I92_00650) | 141367..142275 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
P7I92_RS00655 (P7I92_00655) | 142575..142856 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I92_RS00660 (P7I92_00660) | 142853..143080 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I92_RS00665 (P7I92_00665) | 143256..143876 | - | 621 | WP_023086863.1 | hypothetical protein | - |
P7I92_RS00670 (P7I92_00670) | 143977..144477 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
P7I92_RS00675 (P7I92_00675) | 144550..144891 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
P7I92_RS00680 (P7I92_00680) | 144973..146400 | - | 1428 | WP_003083784.1 | GABA permease | - |
P7I92_RS00685 (P7I92_00685) | 146569..148062 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280968 WP_003083773.1 NZ_CP124654:c142856-142575 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|