Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 6755517..6756022 | Replicon | chromosome |
Accession | NZ_CP124652 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00443 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | P7I82_RS31875 | Protein ID | WP_003083773.1 |
Coordinates | 6755741..6756022 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | P7I82_RS31870 | Protein ID | WP_003083775.1 |
Coordinates | 6755517..6755744 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I82_RS31845 (P7I82_31845) | 6750533..6752026 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
P7I82_RS31850 (P7I82_31850) | 6752195..6753622 | + | 1428 | WP_003083784.1 | GABA permease | - |
P7I82_RS31855 (P7I82_31855) | 6753706..6754047 | - | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
P7I82_RS31860 (P7I82_31860) | 6754120..6754620 | - | 501 | WP_003083778.1 | LEA type 2 family protein | - |
P7I82_RS31865 (P7I82_31865) | 6754721..6755341 | + | 621 | WP_003101226.1 | hypothetical protein | - |
P7I82_RS31870 (P7I82_31870) | 6755517..6755744 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I82_RS31875 (P7I82_31875) | 6755741..6756022 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I82_RS31880 (P7I82_31880) | 6756322..6757230 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
P7I82_RS31885 (P7I82_31885) | 6757262..6757672 | - | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I82_RS31890 (P7I82_31890) | 6757852..6758586 | - | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
P7I82_RS31895 (P7I82_31895) | 6758687..6759373 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
P7I82_RS31900 (P7I82_31900) | 6759422..6760771 | - | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280967 WP_003083773.1 NZ_CP124652:6755741-6756022 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|