Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 4291591..4292144 | Replicon | chromosome |
Accession | NZ_CP124652 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00443 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | P7I82_RS20170 | Protein ID | WP_010953434.1 |
Coordinates | 4291591..4291884 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A431XAN4 |
Locus tag | P7I82_RS20175 | Protein ID | WP_003155922.1 |
Coordinates | 4291872..4292144 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I82_RS20150 (P7I82_20150) | 4287486..4287632 | - | 147 | Protein_3977 | DNA binding protein | - |
P7I82_RS20160 (P7I82_20160) | 4289091..4289771 | + | 681 | WP_282425990.1 | hypothetical protein | - |
P7I82_RS20165 (P7I82_20165) | 4290188..4291597 | + | 1410 | WP_034065764.1 | site-specific integrase | - |
P7I82_RS20170 (P7I82_20170) | 4291591..4291884 | - | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I82_RS20175 (P7I82_20175) | 4291872..4292144 | - | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I82_RS20180 (P7I82_20180) | 4292268..4292513 | - | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4262880..4330163 | 67283 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T280964 WP_010953434.1 NZ_CP124652:c4291884-4291591 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A431XAN4 |