Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1401787..1402373 | Replicon | chromosome |
Accession | NZ_CP124652 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00443 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I82_RS06545 | Protein ID | WP_003120987.1 |
Coordinates | 1401787..1402086 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I82_RS06550 | Protein ID | WP_003448662.1 |
Coordinates | 1402083..1402373 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I82_RS06525 (P7I82_06525) | 1396903..1397436 | - | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
P7I82_RS06530 (P7I82_06530) | 1397426..1398751 | - | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
P7I82_RS06535 (P7I82_06535) | 1398755..1400464 | - | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I82_RS06540 (P7I82_06540) | 1400464..1401585 | - | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
P7I82_RS06545 (P7I82_06545) | 1401787..1402086 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I82_RS06550 (P7I82_06550) | 1402083..1402373 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I82_RS06555 (P7I82_06555) | 1402444..1402788 | - | 345 | WP_003448665.1 | hypothetical protein | - |
P7I82_RS06560 (P7I82_06560) | 1402785..1402919 | - | 135 | WP_033179080.1 | hypothetical protein | - |
P7I82_RS06565 (P7I82_06565) | 1402929..1404905 | - | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
P7I82_RS06570 (P7I82_06570) | 1404902..1406791 | - | 1890 | WP_003448700.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1348991..1430532 | 81541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280961 WP_003120987.1 NZ_CP124652:1401787-1402086 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|