Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5803897..5804483 | Replicon | chromosome |
| Accession | NZ_CP124651 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00217 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | P7I79_RS27400 | Protein ID | WP_003120987.1 |
| Coordinates | 5804184..5804483 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | P7I79_RS27395 | Protein ID | WP_003448662.1 |
| Coordinates | 5803897..5804187 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I79_RS27380 (P7I79_27380) | 5799472..5801367 | + | 1896 | WP_155713823.1 | hypothetical protein | - |
| P7I79_RS27385 (P7I79_27385) | 5801364..5803340 | + | 1977 | WP_023093671.1 | DEAD/DEAH box helicase | - |
| P7I79_RS27390 (P7I79_27390) | 5803479..5803814 | + | 336 | WP_022579623.1 | hypothetical protein | - |
| P7I79_RS27395 (P7I79_27395) | 5803897..5804187 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| P7I79_RS27400 (P7I79_27400) | 5804184..5804483 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I79_RS27405 (P7I79_27405) | 5804685..5805809 | + | 1125 | WP_023093672.1 | TcpQ domain-containing protein | - |
| P7I79_RS27410 (P7I79_27410) | 5805809..5807518 | + | 1710 | WP_023093673.1 | PilN family type IVB pilus formation outer membrane protein | - |
| P7I79_RS27415 (P7I79_27415) | 5807522..5808847 | + | 1326 | WP_022579625.1 | type 4b pilus protein PilO2 | - |
| P7I79_RS27420 (P7I79_27420) | 5808837..5809370 | + | 534 | WP_003149521.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5773392..5861571 | 88179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280958 WP_003120987.1 NZ_CP124651:c5804483-5804184 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|