Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5720061..5720647 | Replicon | chromosome |
| Accession | NZ_CP124651 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00217 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | P7I79_RS26915 | Protein ID | WP_003120987.1 |
| Coordinates | 5720348..5720647 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | P7I79_RS26910 | Protein ID | WP_003448662.1 |
| Coordinates | 5720061..5720351 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I79_RS26890 (P7I79_26890) | 5715643..5717532 | + | 1890 | WP_003448700.1 | hypothetical protein | - |
| P7I79_RS26895 (P7I79_26895) | 5717529..5719505 | + | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
| P7I79_RS26900 (P7I79_26900) | 5719515..5719649 | + | 135 | WP_033179080.1 | hypothetical protein | - |
| P7I79_RS26905 (P7I79_26905) | 5719646..5719990 | + | 345 | WP_003448665.1 | hypothetical protein | - |
| P7I79_RS26910 (P7I79_26910) | 5720061..5720351 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| P7I79_RS26915 (P7I79_26915) | 5720348..5720647 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I79_RS26920 (P7I79_26920) | 5720849..5721970 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
| P7I79_RS26925 (P7I79_26925) | 5721970..5723679 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
| P7I79_RS26930 (P7I79_26930) | 5723683..5725008 | + | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
| P7I79_RS26935 (P7I79_26935) | 5724998..5725531 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5694849..5748063 | 53214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280957 WP_003120987.1 NZ_CP124651:c5720647-5720348 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|