Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 2620325..2620878 | Replicon | chromosome |
| Accession | NZ_CP124651 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00217 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q88JZ3 |
| Locus tag | P7I79_RS12355 | Protein ID | WP_010953434.1 |
| Coordinates | 2620585..2620878 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A431XAN4 |
| Locus tag | P7I79_RS12350 | Protein ID | WP_003155922.1 |
| Coordinates | 2620325..2620597 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I79_RS12345 (P7I79_12345) | 2619956..2620201 | + | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| P7I79_RS12350 (P7I79_12350) | 2620325..2620597 | + | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I79_RS12355 (P7I79_12355) | 2620585..2620878 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I79_RS12360 (P7I79_12360) | 2620872..2622281 | - | 1410 | WP_034065764.1 | site-specific integrase | - |
| P7I79_RS12365 (P7I79_12365) | 2622698..2623399 | - | 702 | WP_031640384.1 | hypothetical protein | - |
| P7I79_RS12370 (P7I79_12370) | 2623515..2623661 | + | 147 | Protein_2443 | DNA binding protein | - |
| P7I79_RS12375 (P7I79_12375) | 2623789..2625579 | - | 1791 | WP_023095445.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2585999..2629704 | 43705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T280954 WP_010953434.1 NZ_CP124651:2620585-2620878 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W5CNE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A431XAN4 |