Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 199728..200233 | Replicon | chromosome |
Accession | NZ_CP124651 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00217 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | P7I79_RS00965 | Protein ID | WP_003083773.1 |
Coordinates | 199728..200009 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | P7I79_RS00970 | Protein ID | WP_003083775.1 |
Coordinates | 200006..200233 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I79_RS00940 (P7I79_00940) | 194979..196328 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
P7I79_RS00945 (P7I79_00945) | 196377..197063 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
P7I79_RS00950 (P7I79_00950) | 197164..197898 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
P7I79_RS00955 (P7I79_00955) | 198078..198488 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I79_RS00960 (P7I79_00960) | 198520..199428 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
P7I79_RS00965 (P7I79_00965) | 199728..200009 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I79_RS00970 (P7I79_00970) | 200006..200233 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I79_RS00975 (P7I79_00975) | 200409..201029 | - | 621 | WP_003101226.1 | hypothetical protein | - |
P7I79_RS00980 (P7I79_00980) | 201130..201630 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
P7I79_RS00985 (P7I79_00985) | 201703..202044 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
P7I79_RS00990 (P7I79_00990) | 202128..203555 | - | 1428 | WP_003083784.1 | GABA permease | - |
P7I79_RS00995 (P7I79_00995) | 203724..205217 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280951 WP_003083773.1 NZ_CP124651:c200009-199728 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|